General Information

  • ID:  hor006560
  • Uniprot ID:  P67788
  • Protein name:  Adipokinetic prohormone
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  AKH/HRTH/RPCH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLTFTSSWGGKRAMTNSISCRNDEAIAAIYKAIQNEAERFIMCQKN
  • Length:  46
  • Propeptide:  MYKLTVFLMFIAFVIIAEAQLTFTSSWGGKRAMTNSISCRNDEAIAAIYKAIQNEAERFIMCQKN
  • Signal peptide:  MYKLTVFLMFIAFVIIAEA
  • Modification:  T1 Pyrrolidone carboxylic acid;T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone, released from cells in the corpora cardiaca, causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006560_AF2.pdbhor006560_ESM.pdb

Physical Information

Mass: 600076 Formula: C222H356N66O70S4
Absent amino acids: HPV Common amino acids: A
pI: 8.79 Basic residues: 6
Polar residues: 16 Hydrophobic residues: 15
Hydrophobicity: -44.57 Boman Index: -9738
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 63.91
Instability Index: 2636.3 Extinction Coefficient cystines: 7115
Absorbance 280nm: 158.11

Literature

  • PubMed ID:  2753887
  • Title:  Adipokinetic hormone gene sequence from Manduca sexta.
  • PubMed ID:  4074373
  • Title:  Amino acid sequence of Manduca sexta adipokinetic hormone elucidated by combined fast atom bombardment (FAB)/tandem mass spectrometry.